成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> BNP-32 (HUMAN)

BNP-32 (HUMAN)

BNP-32 (HUMAN) price.
  • $130 - $1342.6
  • Product name: BNP-32 (HUMAN)
  • CAS: 124584-08-3
  • MF: C143H244N50O42S4
  • MW: 3464.05
  • EINECS:1312995-182-4
  • MDL Number:MFCD00133149
  • Synonyms:Nesiritide [USAN:INN];SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26);SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH;H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26);BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN;BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN);BRAIN NATRIURETIC PEPTIDE, HUMAN
17 prices
Selected condition：
Brand
  • AK Scientific
  • Alfa Aesar
  • ApexBio Technology
  • Biosynth Carbosynth
  • Sigma-Aldrich
  • Tocris
Package
  • 250ug
  • 1
  • 100ug
  • 0.5mg
  • 500ug
  • 1mg
  • 2mg
  • 5mg
  • 10mg
  • ManufacturerAK Scientific
  • Product number9798AJ
  • Product descriptionNesiritide
  • Packaging1mg
  • Price$455
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66167
  • Product descriptionBrain Natriuretic Peptide (1-32), human
  • Packaging0.5mg
  • Price$200
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66167
  • Product descriptionBrain Natriuretic Peptide (1-32), human
  • Packaging1mg
  • Price$381
  • Updated2023-06-20
  • Buy
  • ManufacturerApexBio Technology
  • Product numberB5442
  • Product descriptionBrain Natriuretic Peptide (1-32), human
  • Packaging1mg
  • Price$441
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110257
  • Product descriptionBNP-32 (human) hydrochloride
  • Packaging500ug
  • Price$130
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110377
  • Product descriptionBNP-32 (human)
  • Packaging100ug
  • Price$150
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110377
  • Product descriptionBNP-32 (human)
  • Packaging250ug
  • Price$200
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110257
  • Product descriptionBNP-32 (human) hydrochloride
  • Packaging1mg
  • Price$227
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110377
  • Product descriptionBNP-32 (human)
  • Packaging500ug
  • Price$250
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110377
  • Product descriptionBNP-32 (human)
  • Packaging1mg
  • Price$300
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110257
  • Product descriptionBNP-32 (human) hydrochloride
  • Packaging2mg
  • Price$386
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110377
  • Product descriptionBNP-32 (human)
  • Packaging2mg
  • Price$450
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110257
  • Product descriptionBNP-32 (human) hydrochloride
  • Packaging5mg
  • Price$772
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFB110257
  • Product descriptionBNP-32 (human) hydrochloride
  • Packaging10mg
  • Price$1342.6
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberB5900
  • Product descriptionBrain Natriuretic Peptide-32 human ≥97% (HPLC), powder
  • Packaging0.5mg
  • Price$596
  • Updated2024-03-01
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberB5900
  • Product descriptionBrain Natriuretic Peptide-32 human ≥97% (HPLC), powder
  • Packaging1mg
  • Price$1100
  • Updated2024-03-01
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
AK Scientific 9798AJ Nesiritide 1mg $455 2021-12-16 Buy
Alfa Aesar J66167 Brain Natriuretic Peptide (1-32), human 0.5mg $200 2021-12-16 Buy
Alfa Aesar J66167 Brain Natriuretic Peptide (1-32), human 1mg $381 2023-06-20 Buy
ApexBio Technology B5442 Brain Natriuretic Peptide (1-32), human 1mg $441 2021-12-16 Buy
Biosynth Carbosynth FB110257 BNP-32 (human) hydrochloride 500ug $130 2021-12-16 Buy
Biosynth Carbosynth FB110377 BNP-32 (human) 100ug $150 2021-12-16 Buy
Biosynth Carbosynth FB110377 BNP-32 (human) 250ug $200 2021-12-16 Buy
Biosynth Carbosynth FB110257 BNP-32 (human) hydrochloride 1mg $227 2021-12-16 Buy
Biosynth Carbosynth FB110377 BNP-32 (human) 500ug $250 2021-12-16 Buy
Biosynth Carbosynth FB110377 BNP-32 (human) 1mg $300 2021-12-16 Buy
Biosynth Carbosynth FB110257 BNP-32 (human) hydrochloride 2mg $386 2021-12-16 Buy
Biosynth Carbosynth FB110377 BNP-32 (human) 2mg $450 2021-12-16 Buy
Biosynth Carbosynth FB110257 BNP-32 (human) hydrochloride 5mg $772 2021-12-16 Buy
Biosynth Carbosynth FB110257 BNP-32 (human) hydrochloride 10mg $1342.6 2021-12-16 Buy
Sigma-Aldrich B5900 Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder 0.5mg $596 2024-03-01 Buy
Sigma-Aldrich B5900 Brain Natriuretic Peptide-32 human ≥97% (HPLC), powder 1mg $1100 2024-03-01 Buy

Properties

Density :1.52±0.1 g/cm3(Predicted)
RTECS :EE1534000
storage temp. :−20°C
form :powder
color :White to off-white
Water Solubility :Soluble in water at 1mg/ml
Sequence :H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26)
CAS DataBase Reference :124584-08-3

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Brain natriuretic peptide is originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis.

Related product price