Identification | Back Directory | [Name]
BNP-32 (HUMAN) | [CAS]
124584-08-3 | [Synonyms]
BNP HUMAN Nesiritide BNP-32 (HUMAN) BNP (1-32), HUMAN Nesiritide (BNP-32) Brain natriuretic pe Nesiritide [USAN:INN] BNP-32 (HUMAN) USP/EP/BP BNP-32 (human) hydrochloride BRAIN NATRIURETIC PEPTIDE, HUMAN 124584-08-3 Nesiritide [USAN:INN] BRAIN NATRIURETIC PEPTIDE-32 (HUMAN) BRAIN NATRIURETIC PEPTIDE (1-32), HUMAN BRAIN(B-TYPE) NATRIURETIC PEPTIDE-32 (HUMAN) B-TYPE (BRAIN) NATRIURETIC PEPTIDE-32 (HUMAN) Brain Natriuretic Peptide (BNP) (1-32), human Brain Natriuretic Peptide-32 (huMan), Nesiritide Nesiritide,Brain Natriuretic Peptide-32 human,BNP-32, >98% SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (DISULFIDE BRIDGE: 10-26) BNP-32 (huMan)
Brain Natriuretic Peptide-32 (huMan), Nesiritide SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH H-SER-PRO-LYS-MET-VAL-GLN-GLY-SER-GLY-CYS-PHE-GLY-ARG-LYS-MET-ASP-ARG-ILE-SER-SER-SER-SER-GLY-LEU-GLY-CYS-LYS-VAL-LEU-ARG-ARG-HIS-OH (DISULFIDE BRIDGE: 10-26) H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH Acetate salt (Disulfide bond) L-Histidine, L-seryl-L-prolyl-L-lysyl-L-methionyl-L-valyl-L-glutaminylglycyl-L-serylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-arginyl-L-lysyl-L-methionyl-L-α-aspartyl-L-arginyl-L-isoleucyl-L-seryl-L-seryl-L-seryl-L-serylglycyl-L-leucylglycyl-L-cysteinyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-arginyl-,... | [EINECS(EC#)]
1312995-182-4 | [Molecular Formula]
C143H244N50O42S4 | [MDL Number]
MFCD00133149 | [MOL File]
124584-08-3.mol | [Molecular Weight]
3464.04 |
Chemical Properties | Back Directory | [density ]
1.52±0.1 g/cm3(Predicted) | [RTECS ]
EE1534000 | [storage temp. ]
−20°C
| [form ]
powder
| [color ]
White to off-white | [Water Solubility ]
Soluble in water at 1mg/ml | [Sequence]
H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Disulfide bridge: Cys10-Cys26) | [CAS DataBase Reference]
124584-08-3 |
Hazard Information | Back Directory | [Description]
Nesiritide was introduced in the US as a new intravenous treatment for patients with
acutely decompensated congestive heart failure who have dyspnea at rest or with minimal
activity. Nesiritide is the first human recombinant form of the potent vasodilatory B-type
natriuretic peptide (also known as brain natriuretic peptide), a naturally occurring 32 amino
acid peptide with a disulfide-bonded 17 amino acid ring structure. Nesiritide binds to the Atype
natriuretic peptide receptor on the surface of endothelial and smooth muscle cells
stimulating production of the second messenger cGMP which mediates predominantly
vascular smooth muscle cell relaxation. It also facilitates the elimination of sodium and
water by the kidney and decreases the secretion of certain hormones, such as adrenalin,
angiotensin II, aldosterone and endothelin, which provoke long-term detrimental effects
including blood vessel constriction and blood pressure elevation. In clinical trials with heart
failure patients, nesidtide dose-dependently reduced pulmonary capillary wedge pressure,
right atrial pressure and systemic vascular resistance and increased cardiac index without
affecting heart rate. The major adverse effect observed was dose-dependent hypotension.
In a phase III comparative trial, nesiritide was found to be superior to iv. nitroglycerine in its
haemodynamic effects as well as easier to administer and better tolerated. Nesiritide is
cleared by proteolytic cleavage by the enzyme neutral endopeptidase NEP24.11 and by
binding to the C-type natriuretic peptide receptor followed by endocytosis and intracellular
lysosomal hydrolysis. Since it has a short half-life (18 min), nesiritide is administered as a
21μg/kg bolus infusion followed by a continuous maintenance infusion at 0.011μg/kg/min
usually over 24-48 hours. | [Originator]
Scios (US) | [Uses]
Treatment of congestive heart
failure (renin-angiotensin system antagonist). | [Brand name]
Natrecor
(Biochemie, Austria). | [General Description]
The gene encoding brain natriuretic peptide-32 (BNP-32) is localized on human chromosome 1p36.22. It is implicated in several biological functions such as diuresis, natriuresis, hypotensive action and inhibition of aldosterone secretion. BNP-32 acts as a potential biomarker of high left ventricular-diastolic pressure in patients with symptomatic left ventricular (LV) dysfunction. Elevated expression of this protein is observed in acute myocardial infarction (AMI) patients. | [Biological Activity]
Control peptide for Brain Natriuretic Peptide Antibody (BML-BA1117). Blocks antibody reactivity at 100 nmol/ml diluted antiserum. | [Biochem/physiol Actions]
Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. It is involved in blood pressure control and cardiovascular homeostasis. | [storage]
Store at -20°C |
|
|