Glucagon
![]() |
- $71 - $2727.77
- Product name: Glucagon
- CAS: 16941-32-5
- MF: C153H225N43O49S
- MW: 3482.75
- EINECS:685-611-6
- MDL Number:MFCD00167532
- Synonyms:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
37 prices
Brand
- Alfa Aesar
- American Custom Chemicals Corporation
- Apolloscientific
- AvaChem
- Cayman Chemical
- ChemScene
- DC Chemicals
- Sigma-Aldrich
- Usbiological
Package
- 10ug
- 0.1mg
- 100ug
- 0.5mg
- 1mg
- 4mg
- 5MG
- 2x2.94mg
- 10mg
- 25mg
- 50mg
- 100mg
- 1g
- 96Tests
- ManufacturerAlfa Aesar
- Product numberJ60827
- Product descriptionGlucagon (1-29), human
- Packaging0.5mg
- Price$177
- Updated2023-06-20
- Buy
- ManufacturerAlfa Aesar
- Product numberJ60827
- Product descriptionGlucagon (1-29), human
- Packaging1mg
- Price$306
- Updated2023-06-20
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0001463
- Product descriptionGLUCAGON (1 - 29) 95.00%
- Packaging1MG
- Price$427.35
- Updated2021-12-16
- Buy
- ManufacturerAmerican Custom Chemicals Corporation
- Product numberPEP0001463
- Product descriptionGLUCAGON (1 - 29) 95.00%
- Packaging5MG
- Price$2727.77
- Updated2021-12-16
- Buy
- ManufacturerApolloscientific
- Product numberBITH3022
- Product descriptionGlucagon
- Packaging4mg
- Price$513
- Updated2021-12-16
- Buy
- ManufacturerApolloscientific
- Product numberBITH3022
- Product descriptionGlucagon
- Packaging50mg
- Price$1240
- Updated2021-12-16
- Buy
- ManufacturerAvaChem
- Product number2220
- Product descriptionGlucagon
- Packaging5mg
- Price$235
- Updated2021-12-16
- Buy
- ManufacturerAvaChem
- Product number2220
- Product descriptionGlucagon
- Packaging25mg
- Price$435
- Updated2021-12-16
- Buy
- ManufacturerAvaChem
- Product number2220
- Product descriptionGlucagon
- Packaging100mg
- Price$850
- Updated2021-12-16
- Buy
- ManufacturerAvaChem
- Product number2220
- Product descriptionGlucagon
- Packaging1g
- Price$2350
- Updated2021-12-16
- Buy
- ManufacturerCayman Chemical
- Product number24204
- Product descriptionGlucagon ≥95%
- Packaging1mg
- Price$71
- Updated2022-04-27
- Buy
- ManufacturerCayman Chemical
- Product number24204
- Product descriptionGlucagon ≥95%
- Packaging5mg
- Price$281
- Updated2022-04-27
- Buy
- ManufacturerCayman Chemical
- Product number24204
- Product descriptionGlucagon ≥95%
- Packaging10mg
- Price$492
- Updated2022-04-27
- Buy
- ManufacturerCayman Chemical
- Product number24204
- Product descriptionGlucagon ≥95%
- Packaging25mg
- Price$966
- Updated2022-04-27
- Buy
- ManufacturerChemScene
- Product numberCS-5936
- Product descriptionGlucagon(1-29),bovine,human,porcine 99.81%
- Packaging1mg
- Price$72
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-5936
- Product descriptionGlucagon(1-29),bovine,human,porcine 99.81%
- Packaging5mg
- Price$216
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J60827 | Glucagon (1-29), human | 0.5mg | $177 | 2023-06-20 | Buy |
Alfa Aesar | J60827 | Glucagon (1-29), human | 1mg | $306 | 2023-06-20 | Buy |
American Custom Chemicals Corporation | PEP0001463 | GLUCAGON (1 - 29) 95.00% | 1MG | $427.35 | 2021-12-16 | Buy |
American Custom Chemicals Corporation | PEP0001463 | GLUCAGON (1 - 29) 95.00% | 5MG | $2727.77 | 2021-12-16 | Buy |
Apolloscientific | BITH3022 | Glucagon | 4mg | $513 | 2021-12-16 | Buy |
Apolloscientific | BITH3022 | Glucagon | 50mg | $1240 | 2021-12-16 | Buy |
AvaChem | 2220 | Glucagon | 5mg | $235 | 2021-12-16 | Buy |
AvaChem | 2220 | Glucagon | 25mg | $435 | 2021-12-16 | Buy |
AvaChem | 2220 | Glucagon | 100mg | $850 | 2021-12-16 | Buy |
AvaChem | 2220 | Glucagon | 1g | $2350 | 2021-12-16 | Buy |
Cayman Chemical | 24204 | Glucagon ≥95% | 1mg | $71 | 2022-04-27 | Buy |
Cayman Chemical | 24204 | Glucagon ≥95% | 5mg | $281 | 2022-04-27 | Buy |
Cayman Chemical | 24204 | Glucagon ≥95% | 10mg | $492 | 2022-04-27 | Buy |
Cayman Chemical | 24204 | Glucagon ≥95% | 25mg | $966 | 2022-04-27 | Buy |
ChemScene | CS-5936 | Glucagon(1-29),bovine,human,porcine 99.81% | 1mg | $72 | 2021-12-16 | Buy |
ChemScene | CS-5936 | Glucagon(1-29),bovine,human,porcine 99.81% | 5mg | $216 | 2021-12-16 | Buy |
Properties
Density :1.53±0.1 g/cm3(Predicted)
storage temp. :Keep in dark place,Sealed in dry,2-8°C
solubility :Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form :powder
color :White to off-white
biological source :synthetic
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :MASNOZXLGMXCHN-SXVMFYJYNA-N
storage temp. :Keep in dark place,Sealed in dry,2-8°C
solubility :Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form :powder
color :White to off-white
biological source :synthetic
Water Solubility :Soluble to 1 mg/ml in water
InChIKey :MASNOZXLGMXCHN-SXVMFYJYNA-N
Safety Information
Symbol(GHS): |
![]() ![]() |
||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Signal word: | Danger | ||||||||||||||||||||||||||||
Hazard statements: |
|
||||||||||||||||||||||||||||
Precautionary statements: |
|
Description
A peptide hormone that plays a role in maintaining glucose homeostasisRelated product price
- GLP-1
$80-2882 - Oxytocin
$24.8-2395.3 - Octreotide acetate
$32-1802
Suppliers and manufacturers
Apeloa production Co.,Limited
Cellmano Biotech Limited
Apextide Co Ltd
GIHI CHEMICALS CO.,LIMITED