Obtustatin Chemische Eigenschaften,Einsatz,Produktion Methoden

Enzyminhibitor

This 41-residue disintegrin (FW = 4401 g/mol; Sequence CTTGPCCRQ CKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG, with disulfide bonds at Cys1-Cys10, Cys6-Cys29, Cys7-Cys34, and Cys19-Cys36) from the venom of the blunt-nosed viper Vipera lebetina obtusa exhibits tight binding to integrins, inhibiting platelet aggregation, IC50 = 2 nM. It is the shortest polypeptide to contain an integrin-recognition loop. Target(s): Obtustatin is a highly potent integrin α1β1 inhibitor (IC50 = 0.8 nM for α1β1 binding to type IV collagen), displaying specificity for α1β1 over α2β1, αIIbβ3, αvβ3, α4β1, α5β6, α9β1 and α4β7.

Obtustatin Upstream-Materialien And Downstream Produkte

Upstream-Materialien

Downstream Produkte

Obtustatin Anbieter Lieferant Produzent Hersteller Vertrieb H?ndler.

Firmenname	Telefon	E-Mail	Land	Produktkatalog	Edge Rate
BOC Sciences	+1-631-485-4226	inquiry@bocsci.com	United States	19553	58
Shanghai Longyu Biotechnology Co., Ltd.	+8619521488211	info@longyupharma.com	China	2542	58
Changsha MOL Changes Biotechnology Co., Ltd.	+8619375158599	info@molchanges.com	China	5223	58
Wuxi Zhongkun Biochemical Technology Co., Ltd.	0510-85629785 18013409632	sales@reading-chemicals.com	China	15178	58
Creative Peptides		info@creative-peptides.com	United States	6083	56
Hangzhou Peptidego Biotech Co.,Ltd.	0571-87213919	Eric@peptidego.com	China	6968	58
Wuxi Helen Biotechnology Co., Ltd.,	0510-85629785 18013409632	sales@reading-chemicals.com	China	14081	58
Nanjing Yuanpeptide Biotech Co.，Ltd.	18168071971	support@yuan-peptide.com	China	2980	58
Shaoxing Junyu Biotechnology Co., LTD	0571-88211921 15572296305	sales4@gotopbio.com	China	5178	58
Hangzhou Sinoda Pharmaceutical Technology Co. LTD	0571-87213919 17306812703	3007955328@qq.com	China	6659	58

---

• CTTGPCCRQCKLKPAGTTCWKTSLTSHYCTGKSCDCPLYPG(MODIFICATIONS: DISULFIDE BRIDGE: 1-10,6-29,7-34,19-36)
• Obtustatin