GLUCAGON (1-37) (PORCINE)
- $346 - $2696.2
- Product name: GLUCAGON (1-37) (PORCINE)
- CAS: 62340-29-8
- MF: C192H295N59O60S
- MW: 0
- EINECS:
- MDL Number:MFCD00081799
- Synonyms:OXYNTOMODULIN;OXYNTOMODULIN (PORCINE);ENTEROGLUCAGON;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;GLUCAGON 37;GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE)
7 prices
Selected condition:
Brand
- ApexBio Technology
- Biorbyt Ltd
- Tocris
- Usbiological
Package
- 1
- 1mg
- 5mg
- 10mg
- 96Tests
- ManufacturerApexBio Technology
- Product numberB5259
- Product descriptionOxyntomodulin
- Packaging1mg
- Price$503
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372632
- Product descriptionOxyntomodulin > 95%
- Packaging1mg
- Price$727.6
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372632
- Product descriptionOxyntomodulin > 95%
- Packaging5mg
- Price$1802
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb372632
- Product descriptionOxyntomodulin > 95%
- Packaging10mg
- Price$2696.2
- Updated2021-12-16
- Buy
- ManufacturerTocris
- Product number2094
- Product descriptionOxyntomodulin(porcine,bovine)
- Packaging1
- Price$346
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number152918
- Product descriptionOxyntomodulin
- Packaging96Tests
- Price$918
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number256135
- Product descriptionOxyntomodulin
- Packaging1mg
- Price$644
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
ApexBio Technology | B5259 | Oxyntomodulin | 1mg | $503 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372632 | Oxyntomodulin > 95% | 1mg | $727.6 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372632 | Oxyntomodulin > 95% | 5mg | $1802 | 2021-12-16 | Buy |
Biorbyt Ltd | orb372632 | Oxyntomodulin > 95% | 10mg | $2696.2 | 2021-12-16 | Buy |
Tocris | 2094 | Oxyntomodulin(porcine,bovine) | 1 | $346 | 2021-12-16 | Buy |
Usbiological | 152918 | Oxyntomodulin | 96Tests | $918 | 2021-12-16 | Buy |
Usbiological | 256135 | Oxyntomodulin | 1mg | $644 | 2021-12-16 | Buy |
Properties
storage temp. :Desiccate at -20°C
form :Powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
form :Powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
Sequence :H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Related product price
- 81123-06-0
$262-1240 - 39024-57-2
$108-376 - Melanotan-1
$75-856
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Career Henan Chemica Co
BOC Sciences
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
Zhejiang Hangyu API Co., Ltd
Wuhan Topule Biopharmaceutical Co., Ltd
LEAPCHEM CO., LTD.