成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> CECROPIN B

CECROPIN B

CECROPIN B price.
  • $63 - $1478.25
  • Product name: CECROPIN B
  • CAS: 80451-05-4
  • MF: C176H302N52O41S
  • MW: 3834.66988
  • EINECS:
  • MDL Number:MFCD00130753
  • Synonyms:KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);Cecropin B, ≥97% (HPLC)
25 prices
Selected condition：
Brand
  • Alfa Aesar
  • Biorbyt Ltd
  • Biosynth Carbosynth
  • ChemScene
  • DC Chemicals
  • Sigma-Aldrich
  • TRC
  • Usbiological
Package
  • 100ug
  • 0.1mg
  • 250ug
  • 500ug
  • 1mg
  • 2mg
  • 2.5mg
  • 5mg
  • 10mg
  • ManufacturerAlfa Aesar
  • Product numberJ66068
  • Product descriptionCecropin B, amide
  • Packaging1mg
  • Price$370
  • Updated2023-06-20
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66068
  • Product descriptionCecropin B, amide
  • Packaging5mg
  • Price$721
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66068
  • Product descriptionCecropin B, amide
  • Packaging10mg
  • Price$1030
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66041
  • Product descriptionCecropin B free acid
  • Packaging10mg
  • Price$1211
  • Updated2023-06-20
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611693
  • Product descriptionCecropin B
  • Packaging1mg
  • Price$287.3
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611693
  • Product descriptionCecropin B
  • Packaging5mg
  • Price$630.7
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb611693
  • Product descriptionCecropin B
  • Packaging10mg
  • Price$793.9
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC73321
  • Product descriptionCecropin B
  • Packaging100ug
  • Price$63
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC73321
  • Product descriptionCecropin B
  • Packaging250ug
  • Price$125
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC73321
  • Product descriptionCecropin B
  • Packaging500ug
  • Price$220
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC73321
  • Product descriptionCecropin B
  • Packaging1mg
  • Price$380
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC108880
  • Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
  • Packaging5mg
  • Price$1478.25
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC108880
  • Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
  • Packaging2mg
  • Price$680
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC108880
  • Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
  • Packaging1mg
  • Price$400
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC108880
  • Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
  • Packaging500ug
  • Price$230
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFC108880
  • Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
  • Packaging250ug
  • Price$132.5
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66068 Cecropin B, amide 1mg $370 2023-06-20 Buy
Alfa Aesar J66068 Cecropin B, amide 5mg $721 2021-12-16 Buy
Alfa Aesar J66068 Cecropin B, amide 10mg $1030 2021-12-16 Buy
Alfa Aesar J66041 Cecropin B free acid 10mg $1211 2023-06-20 Buy
Biorbyt Ltd orb611693 Cecropin B 1mg $287.3 2021-12-16 Buy
Biorbyt Ltd orb611693 Cecropin B 5mg $630.7 2021-12-16 Buy
Biorbyt Ltd orb611693 Cecropin B 10mg $793.9 2021-12-16 Buy
Biosynth Carbosynth FC73321 Cecropin B 100ug $63 2021-12-16 Buy
Biosynth Carbosynth FC73321 Cecropin B 250ug $125 2021-12-16 Buy
Biosynth Carbosynth FC73321 Cecropin B 500ug $220 2021-12-16 Buy
Biosynth Carbosynth FC73321 Cecropin B 1mg $380 2021-12-16 Buy
Biosynth Carbosynth FC108880 Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 5mg $1478.25 2021-12-16 Buy
Biosynth Carbosynth FC108880 Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 2mg $680 2021-12-16 Buy
Biosynth Carbosynth FC108880 Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 1mg $400 2021-12-16 Buy
Biosynth Carbosynth FC108880 Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 500ug $230 2021-12-16 Buy
Biosynth Carbosynth FC108880 Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 250ug $132.5 2021-12-16 Buy

Properties

storage temp. :−20°C
form :powder
color :White to off-white
Water Solubility :Water : 20 mg/mL (5.22 mM)
Sequence :H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description

Cecropin B is an antibacterial peptide isolated from pig intestine and moths.

Related product price