CALCITONIN, HUMAN
|
- $55 - $1440
- Product name: CALCITONIN, HUMAN
- CAS: 21215-62-3
- MF: C151H226N40O45S3
- MW: 3417.85
- EINECS:244-276-2
- MDL Number:MFCD00167520
- Synonyms:calcitonin M;THYROCALCITONIN HUMAN;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;H-CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 (DISULFIDE BRIDGE: 1-7);CYST-GLY-ASN-LEU-SER-THR-CYST-MET-LEU-GLY-THR-TYR-THR-GLN-AS-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2;CYS-GLY-ASN-LEU-SER-THR-CYS-MET-LEU-GLY-THR-TYR-THR-GLN-ASP-PHE-ASN-LYS-PHE-HIS-THR-PHE-PRO-GLN-THR-ALA-ILE-GLY-VAL-GLY-ALA-PRO-NH2 HUMAN;CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (DISULFIDE BRIDGE: 1-7)
16 prices
Selected condition：
Brand
- Alfa Aesar
- Biosynth Carbosynth
- ChemScene
- Sigma-Aldrich
- Tocris
Package
- 100ug
- 250ug
- 500ug
- 0.5mg
- 1mg
- 2mg
- 5mg
- 10mg
- 500U
- ManufacturerAlfa Aesar
- Product numberJ63192
- Product descriptionCalcitonin, human, 97+%
- Packaging0.5mg
- Price$282
- Updated2023-06-20
- Buy
- ManufacturerAlfa Aesar
- Product numberJ63192
- Product descriptionCalcitonin, human, 97+%
- Packaging1mg
- Price$385
- Updated2023-06-20
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging100ug
- Price$55
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging250ug
- Price$110
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging500ug
- Price$120
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging500ug
- Price$190
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging1mg
- Price$210
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging1mg
- Price$330
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging2mg
- Price$365
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73302
- Product descriptionCalcitonin, human
- Packaging2mg
- Price$561
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging5mg
- Price$730
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108641
- Product descriptionCalcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond)
- Packaging10mg
- Price$1269.6
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-0121007
- Product descriptionCalcitonin human 96.06%
- Packaging1mg
- Price$200
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-0121007
- Product descriptionCalcitonin human 96.06%
- Packaging5mg
- Price$550
- Updated2021-12-16
- Buy
- ManufacturerSigma-Aldrich
- Product numberT3535
- Product descriptionCalcitonin human ≥97% (HPLC), powder
- Packaging1mg
- Price$1440
- Updated2024-03-01
- Buy
- ManufacturerTocris
- Product number6031
- Product descriptionCalcitonin human
- Packaging500U
- Price$268
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Alfa Aesar | J63192 | Calcitonin, human, 97+% | 0.5mg | $282 | 2023-06-20 | Buy |
| Alfa Aesar | J63192 | Calcitonin, human, 97+% | 1mg | $385 | 2023-06-20 | Buy |
| Biosynth Carbosynth | FC73302 | Calcitonin, human | 100ug | $55 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73302 | Calcitonin, human | 250ug | $110 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 500ug | $120 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73302 | Calcitonin, human | 500ug | $190 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 1mg | $210 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73302 | Calcitonin, human | 1mg | $330 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 2mg | $365 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC73302 | Calcitonin, human | 2mg | $561 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 5mg | $730 | 2021-12-16 | Buy |
| Biosynth Carbosynth | FC108641 | Calcitonin (human) trifluoroacetate salt H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 trifluoroacetate salt (Disulfide bond) | 10mg | $1269.6 | 2021-12-16 | Buy |
| ChemScene | CS-0121007 | Calcitonin human 96.06% | 1mg | $200 | 2021-12-16 | Buy |
| ChemScene | CS-0121007 | Calcitonin human 96.06% | 5mg | $550 | 2021-12-16 | Buy |
| Sigma-Aldrich | T3535 | Calcitonin human ≥97% (HPLC), powder | 1mg | $1440 | 2024-03-01 | Buy |
| Tocris | 6031 | Calcitonin human | 500U | $268 | 2021-12-16 | Buy |
Properties
Boiling point :3061.8±65.0 °C(Predicted)
Density :1.326±0.06 g/cm3(Predicted)
RTECS :XP3560000
storage temp. :−20°C
solubility :Soluble in DMSO
form :powder
color :White to off-white
Water Solubility :Soluble to 2 mg/ml in water
Merck :13,1642
Density :1.326±0.06 g/cm3(Predicted)
RTECS :XP3560000
storage temp. :−20°C
solubility :Soluble in DMSO
form :powder
color :White to off-white
Water Solubility :Soluble to 2 mg/ml in water
Merck :13,1642
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
Decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. A carrier peptide that can be used to internalize fusion proteinsRelated product price
- CALCITONIN (PORCINE)
$130-1347.8 - CALCITONIN, RAT
$55-1347.8 - ALPHA-CGRP (RAT)
$165-864.7
