成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> ACTH (7-38) (HUMAN)

ACTH (7-38) (HUMAN)

ACTH (7-38) (HUMAN) price.
  • $92.4 - $1866.6
  • Product name: ACTH (7-38) (HUMAN)
  • CAS: 68563-24-6
  • MF: C167H257N47O46
  • MW: 3659.11
  • EINECS:
  • MDL Number:MFCD00081282
  • Synonyms:acth(7-38 ;FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE;H-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-OH;CORTICOTROPIN A;CORTICOTROPIN-LIKE INTERMEDIATE PEPTIDE HUMAN (7-38);CORTICOTROPIN-INHIBITING PEPTIDE;CORTICOTROPIN-INHIBITING PEPTIDE (HUMAN);CIP (HUMAN)
14 prices
Selected condition:
Brand
  • Alfa Aesar
  • Biorbyt Ltd
  • Biosynth Carbosynth
  • Sigma-Aldrich
  • Usbiological
Package
  • 250μg
  • 0.5mg
  • 500ug
  • 1mg
  • 2mg
  • 5mg
  • 10mg
  • ManufacturerAlfa Aesar
  • Product numberJ66765
  • Product descriptionAdrenocorticotropic Hormone (7-38), human
  • Packaging0.5mg
  • Price$139
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66765
  • Product descriptionAdrenocorticotropic Hormone (7-38), human
  • Packaging1mg
  • Price$209
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364165
  • Product descriptionACTH (7-38) > 95%
  • Packaging1mg
  • Price$588.2
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364165
  • Product descriptionACTH (7-38) > 95%
  • Packaging5mg
  • Price$1247.8
  • Updated2021-12-16
  • Buy
  • ManufacturerBiorbyt Ltd
  • Product numberorb364165
  • Product descriptionACTH (7-38) > 95%
  • Packaging10mg
  • Price$1866.6
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFA108380
  • Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
  • Packaging500ug
  • Price$130
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFA108380
  • Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
  • Packaging1mg
  • Price$228
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFA108380
  • Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
  • Packaging2mg
  • Price$388
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFA108380
  • Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
  • Packaging5mg
  • Price$776
  • Updated2021-12-16
  • Buy
  • ManufacturerBiosynth Carbosynth
  • Product numberFA108380
  • Product descriptionACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH
  • Packaging10mg
  • Price$1349.6
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberA1527
  • Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
  • Packaging250μg
  • Price$92.4
  • Updated2024-03-01
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberA1527
  • Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
  • Packaging0.5mg
  • Price$145.2
  • Updated2024-03-01
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberA1527
  • Product descriptionAdrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC)
  • Packaging1mg
  • Price$594
  • Updated2024-03-01
  • Buy
  • ManufacturerUsbiological
  • Product numberC7903-80F
  • Product descriptionCorticotropin Inhibiting Peptide
  • Packaging1mg
  • Price$262
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66765 Adrenocorticotropic Hormone (7-38), human 0.5mg $139 2021-12-16 Buy
Alfa Aesar J66765 Adrenocorticotropic Hormone (7-38), human 1mg $209 2021-12-16 Buy
Biorbyt Ltd orb364165 ACTH (7-38) > 95% 1mg $588.2 2021-12-16 Buy
Biorbyt Ltd orb364165 ACTH (7-38) > 95% 5mg $1247.8 2021-12-16 Buy
Biorbyt Ltd orb364165 ACTH (7-38) > 95% 10mg $1866.6 2021-12-16 Buy
Biosynth Carbosynth FA108380 ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH 500ug $130 2021-12-16 Buy
Biosynth Carbosynth FA108380 ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH 1mg $228 2021-12-16 Buy
Biosynth Carbosynth FA108380 ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH 2mg $388 2021-12-16 Buy
Biosynth Carbosynth FA108380 ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH 5mg $776 2021-12-16 Buy
Biosynth Carbosynth FA108380 ACTH (7-38) (human) H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH 10mg $1349.6 2021-12-16 Buy
Sigma-Aldrich A1527 Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) 250μg $92.4 2024-03-01 Buy
Sigma-Aldrich A1527 Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) 0.5mg $145.2 2024-03-01 Buy
Sigma-Aldrich A1527 Adrenocorticotropic Hormone Fragment 7-38 human ≥97% (HPLC) 1mg $594 2024-03-01 Buy
Usbiological C7903-80F Corticotropin Inhibiting Peptide 1mg $262 2021-12-16 Buy

Properties

storage temp. :−20°C
form :Solid
color :White to off-white
Sequence :H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH

Safety Information

Symbol(GHS):
Signal word:
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
Precautionary statements:

Description


Related product price