成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

GL Biochem (Shanghai) Ltd

GL Biochem (Shanghai) Ltd

Current Location: HOME >> Product
Product Categories
Country: China
Tel: 21-21-61263452
Mobile: 13641803416
E-mail:
QQ:
Skype: Chat Now!
Company Name:Shanghai GL Peptide Ltd
Tel:86-21-61263385
Fax:86-21-61263399
Email:ymbetter@glbiochem
WebSite:http://www.glbiochem.com
Nationality:CHINA
Product Name MF CAS Details
Neuropeptide Y, human, Free Acid Details
Neuropeptide Y, human, rat, [D-Trp32]- Details
Neuropeptide Y, human, rat, [Leu31,Pro34]- Details
Neuropeptide Y, human, rat, Biotinyl- Details
Myristoylated ADP - Ribosylation Factor 6, myr - ARF6 (2 - 13) Details
Myristoylated Protein Kinase C (19-31) Details
Myristoyl-Lys-Arg-Thr-Leu-Arg-OH C42H82N12O8 125678-68-4 Details
Myristoyl-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-OH C60H105N17O12 147217-25-2 Details
N-((RS)-2-Hydroxy-1-phenyl-ethyl)-Val-Leu-anilide C25H35N3O3 283159-27-3 Details
N-((RS)-2-Hydroxy-2-phenyl-ethyl)-Val-Leu-anilide C25H35N3O3 282732-35-8 Details
N-((RS)-2-Hydroxy-propyl)-Val-Leu-anilide C20H33N3O3 282726-24-3 Details
N-((RS)-3-Chloro-2-hydroxy-propyl)-Val-Leu-anilide C20H32ClN3O3 282726-25-4 Details
Neuropeptide Y, porcine;YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 C190H287N55O57 82785-45-3 Details
Neuropeptide Y (NPY) and Related Peptides Details
Neuropeptide Y (human, rat) Acetate 200 μg/vial (Clinalfa basic) Details
Neuropeptide Y, human, rat;YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 C189H285N55O57S 99575-89-0 Details
Neuropeptide Y (free acid) (human) Details
Neuropeptide Y (3-36), porcine;SKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 C176H271N53O54 143863-88-1 Details
Neuropeptide Y (3-36), human, rat;SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 C175H269N53O54S1 150138-78-6 Details
Neuropeptide Y (27-36), [D-Tyr27&36,D-Thr32]- Details
Neuropeptide Y (2-36), porcine;PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 102961-52-4 Details
Neuropeptide Y (2-36), human, rat;PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 123139-39-9 Details
Neuropeptide Y (22-36), porcine;SALRHYINLITRQRY-NH2 C85H139N29O21 119019-65-7 Details
Neuropeptide Y (13-36), porcine, [Leu31,Pro34]- Details
Neuropeptide Y (13-36), human, rat, [Leu31,Pro34]- Details
Neuropeptide Y(13-36), porcine;PAEDLARYYSALRHYINLITRQRY-NH2 C135H209N41O36 113662-54-7 Details
Neuropeptide Y (13-36), human, rat;PAEDMARYYSALRHYINLITRQRY-NH2 C134H207N41O36S 122341-40-6 Details
Neuropeptide Y (1-24) amide, human, rat;YPSKPDNPGEDAPAEDMARYYSAL-NH2 C116H170N30O40S 131448-51-6 Details
Neuropeptide W-30 (rat) C165H249N49O38S 383415-90-5 Details
Neuropeptide W-30 (human) C165H249N49O37S 383415-80-3 Details
Neuropeptide W-23 (rat) C119H183N35O29S 383415-89-2 Details
Neuropeptide W-23 (human) C119H183N35O28S 383415-79-0 Details
Neuropeptide VF (56-92) (human) 381006-66-2 Details
Neuropeptide VF (124-131) (human) C45H72N14O10 311309-27-0 Details
Neuropeptide SF (human) C65H94N18O15 192387-39-6 Details
Neuropeptide SF Details
Neuropeptide S, NPS, rat;SFRNGVGSGVKKTSFRRAKQ C95H160N34O27 412938-75-1 Details
Neuropeptide S, NPS, human;SFRNGVGTGMKKTSFQRAKS C93H155N31O28S 412938-67-1 Details
Neuropeptide S (1-10) (human) C42H68N14O14S 904910-39-0 Details
Neuropeptide GE C81H125N23O34 134748-04-2 Details
Neuropeptide Y, porcine, [D-Trp32]- Details
Neuropeptide Y, porcine, [Leu31,Pro34]- Details
Neuropeptide Y, porcine, [Pro34]- Details
Neuropeptide Y, porcine, Biotinyl- Details
Neuropeptide Y, porcine, Free Acid Details
Neuropeptide Y(18-36), porcine;ARYYSALRHYINLITRQRY-NH2 C109H169N35O26 98264-90-5 Details
Neuropeptide γ Details
Neurotensin;Pyr-LYENKPRRPYIL C78H121N21O20 55508-42-4 Details
Neurotensin (1-8) C46H71N13O14 80887-44-1 Details
Neurotensin (Frog) C70H115N23O17 Details
Neuronostatin-13 (human, canine, porcine) Details
Neuronostatin-13 (mouse, rat) Details
Neuronostatin-19 (human, canine, porcine) C90H151N29O25 1872435-06-7 Details
Neuronostatin-19 (mouse, rat) Details
Neuropeptide AF Details
Neuropeptide AF (human) C90H132N26O25 192387-38-5 Details
Neuropeptide F;PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2 136697-70-6 Details
Neuropeptide FF Morphine Modulating Neuropeptide F-8-F-NH2 C54H76N14O10 99566-27-5 Details
Neuropeptide FF Morphine Modulating Neuropeptide Details
Neuropeptide FF-amide Details
N-(2-Carbamoyl-ethyl)-Val-Leu-anilide C20H32N4O3 282725-67-1 Details
N-(Cyanur-2-yl)-Asp-Ala-anilide Details
N(p-Tosyl)-GPR-pNA C26H34N8O7S Details
N,S-Bis-Fmoc-glutathione C40H37N3O10S 149438-56-2 Details
N-[(2RS,3RS)-2,3,4-Trihydroxy-butyl]-Val-Leu-anilide C21H35N3O5 1926163-76-9 Details
N-[(RS)-1-Carboxy-3-phenyl-propyl]-Ala-Ala-Phe-4-Abz-OH Details
N-[(RS)-2-Carbamoyl-2-hydroxy-ethyl]-Val-Leu-anilide C20H32N4O4 1926163-77-0 Details
N1-Glutathionyl-spermidine disulfide C34H66N12O10S2 108081-77-2 Details
N-2-Aminoethyl-Val-Leu-anilide C19H32N4O2 282732-36-9 Details
N-2-Chloroethyl-Val-Leu-anilide C19H30ClN3O2 282729-48-0 Details
N-2-Cyanoethyl-Val-Leu-anilide C20H30N4O2 194351-52-5 Details
N-2-Ethoxyethyl-Val-Ala-anilide C18H29N3O3 194351-51-4 Details
Nesfatin-1 (mouse) 917528-36-0 Details
Neurokinins, Neuromedins, Other Tachykinins and Related Peptides Details
N-cis-2,6-Dimethylpiperidinocarbonyl-β-tBu-Ala-D-Trp(1-methoxycarbonyl)-D-Nle-OH Details
N-2-Hydroxyethyl-Val-Leu-anilide C19H31N3O3 194351-53-6 Details
Neuromedin (U-25), porcine;FKVDEEFQGPIVSQNRRYFLFRPRN-NH2 C144H217N43O37 98395-76-7 Details
Nazumamide A C28H43N7O8 138949-86-7 Details
Neurokinin Receptor (393-407), rat;KTMTESSFYSNMLA C69H108N16O24S2 Details
Nectofibrin Hexapeptide (rat) C32H47N7O9 123402-49-3 Details
Nesfatin-1 (rat) 917528-37-1 Details
Neurokinin A: Substance K: Neuromedin L: NKA;HKTDSFVGLM-NH2 C50H80N14O14S 86933-74-6 Details
Nephilatoxin NPTX-11 C24H37N7O4 119613-54-6 Details
Neoendorphin (1-5), α- Details
Ne-Trifluoroacetyl-L-lysine C8H13F3N2O3 10009-20-8 Details
Neuromedin U, rat;YKVNEYQGPVAPSGGFFLFRPRN-NH2 C124H180N34O31 117505-80-3 Details
Neo-Kyotorphin C28H47N9O9 83759-54-0 Details
Neuromedin S, human??;ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 1138204-27-9 Details
Neuroendocrine Regulatory Peptide-1 (rat) C110H180N32O38 954420-51-0 Details
Neuroendocrine Regulatory Peptide-2 (human) Details
Nesfatin-1 (human) 917528-35-9 Details
Neurokinin A (4-10), [?-Ala8]- Details
N-Et-Val-Leu-anilide C19H31N3O2 282726-22-1 Details
Nephilatoxin NPTX-9 C30H49N11O5 114355-42-9 Details
Neuromedin U-23 (rat) Details
Neuromedin N;KIPYIL-NH2 C38H63N7O8 92169-45-4 Details
Neuromedin (U-8), porcine;YFLFRPRN-NH2 C54H78N16O10 98395-75-6 Details
Neuroendocrine Regulatory Peptide-1 (human) C113H192N36O39 954420-50-9 Details
Neuroendocrine Regulatory Peptide-2 (rat) Details
Neuromedin S (rat) C193H307N57O49S 843782-19-4 Details
Product Total: Product Page:
47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100