Product Name | MF | CAS | Details |
---|
Recombinant Mouse Testican-3 , C-6His, Human cells | Details |
Recombinant Mouse Tissue Factor (29-251), C-6His, Human Cells | Details |
Recombinant Mouse Ectodysplasin A2 Receptor , C-6His, Human Cells | Details |
Recombinant Mouse Triggering Receptor Expressed On Myeloid Cells 1 , C-6His, Human Cells | Details |
Recombinant Mouse OX40 Ligand , N-8His, Human Cells | Details |
Recombined Surface Antigen of Hepatitis B virus | Details |
Polyporusterone B, 10 mM in DMSO | C28H44O6 | 141360-89-6 | Details |
Spin Albumin and IgG Erasin Kit | Details |
Polyporusterone A | C28H46O6 | 141360-88-5 | Details |
8-Amino-1-Naphthalenesulfonic Acid | C10H9NO3S | 82-75-7 | Details |
Recombinant Porcine Interleukin-2 | Details |
Recombinant Mouse T-cell Immunoreceptor With Ig Wnd ITIM Domains , C-Fc, Human cells | Details |
Recombinant Mouse Thrombopoietin , N-6His, Human Cells | Details |
Recombinant Mouse/Rat Transforming Growth Factor Beta 1 , None, Human cells | Details |
Recombinant Mouse Triggering Receptor Expressed On Myeloid Cells 2b , C-6His, Human cells | Details |
Recombinant Mouse UL16 Binding Protein-1/NKG2D Ligand 1 , C-6His, Human cells | Details |
Recombinant Anti-SARS-CoV-2 N mouse monoclonal antibody | Details |
Dynorphin A (1-13), amide, porcine | C75H127N25O14 | 79515-34-7 | Details |
Recombinant Porcine Interleukin-1 Receptor Antagonist Protein | Details |
Zuclopenthixol, 10 mM in DMSO | C22H25ClN2OS | 53772-83-1 | Details |
Recombinant Porcine Interleukin-1 beta | Details |
Recombinant Mouse CoagulationFactor X , C-6His, Human cells | Details |
Recombinant Mouse Transglutaminase 2 , C-6His, Human cells | Details |
Recombinant Mouse TNF-like 1 , None, E.coli | Details |
Recombinant Mouse Transforming Growth Factor-beta Receptor Type II , C-Fc, Human Cells | Details |
Recombinant Mouse Epithelial Cell Adhesion Molecule , C-Fc, Human Cells | Details |
Recombinant Mouse Vascular Endothelial Growth Factor A , None, P. pastoris | Details |
Recombinant Murine Uteroglobin | Details |
Pig ACTB Endogenous Reference Genes Primers, 10 μM | Details |
Hypocrellin A | C30H26O10 | 77029-83-5 | Details |
Hyocholic acid, 10 mM in DMSO | C24H40O5 | 547-75-1 | Details |
Recombinant Mouse C-X-C Motif Chemokine 16 , C-6His, Human cells | Details |
Recombinant Mouse D, C-6His, Human Cells | Details |
Recombinant Mouse Ectodysplasin A2 Receptor , C-Fc, Human Cells | Details |
Recombinant Mouse Tryptase Beta-2 , C-6His, Human Cells | Details |
Recombinant Human Tumor Necrosis Factor Receptor I (30-211), C-Fc, Human cells | Details |
Niranthin, 10 mM in DMSO | C24H32O7 | 50656-77-4 | Details |
Recombinant Murine soluble Tumor Necrosis Factor Receptor Type II/TNFRSF1B | Details |
TGEV LFD Cards | Details |
EZ-10 Spin Column Viral Total RNA Extraction Kit | Details |
Dynorphin (2-17), amide, porcine | C90H147N31O20 | Details |
Angiotensinogen (1-14), porcine | C85H123N21O20 | 64315-16-8 | Details |
Recombinant Mouse SLAM Family Member 8 , C-6His, Human Cells | Details |
Recombinant Mouse T, None, Human Cells | Details |
Recombinant Mouse Ephrin-A1 , C-Fc-6His, Human cells | Details |
Recombinant Mouse Triggering Receptor Expressed On Myeloid Cells 2b , C-Fc, Human cells | Details |
Recombinant Mouse Thymic Stromal Lymphopoietin Protein Receptor , C-Fc, Human cells | Details |
Recombinant Anti-SARS-CoV-2 RBD mouse monoclonal nanobody | Details |
Pro-Adrenomedullin (N-20), porcine | C112H178N36O26 | Details |
Pig IgG | Details |
Hyodeoxycholic acid, 10 mM in DMSO | C24H40O4 | 83-49-8 | Details |
Recombinant Porcine Interleukin-8/CXCL8 | Details |
Dynorphin A (2-17), porcine | C90H146N30O21 | Details |
Recombinant Mouse Tumor-associated Calcium Signal Transducer 2 , C-6His, Human Cells | Details |
Recombinant Mouse/Rat Transforming Growth Factor Beta 2 , None, Human cells | Details |
Recombinant Protein (Murine Tumor Necrosis Factor-alpha) | Details |
Recombinant Mouse Trefoil Factor 1 , C-6His, Human Cells | Details |
Recombinant Mouse TNF-related Weak Inducer of Apoptos, C-Fc, Human cells | Details |
Recombinant Mouse V-Set And Ig Domain-Containing Protein 4 , C-6His, Human Cells | Details |
Recombinant Murine Vascular Endothelial | Details |
Pig GAPDH Endogenous Reference Genes Primers, 10 μM | Details |
Spin Column Blood Total RNA Purification Kit | Details |
Recombinant Mouse SLAM Family Member 9 , C-6His, Human cells | Details |
Recombinant Mouse Alpha-N-acetylgalactosaminide Alpha-2,6-sialyltransferase 2 , C-6His, Human Cells | Details |
Recombinant Mouse Tumor Necrosis Factor Alpha (89-235), None, E.coli | Details |
Recombinant Mouse Lymphotoxin beta Receptor , C-Fc, Human cells | Details |
Recombinant Mouse Thymic Stromal Lymphopoietin Protein Receptor , C-6His, Human cells | Details |
Recombinant Mouse Tumor Necros, C-10His, Human Cells | Details |
Recombinant Murine Thymus and Activation Regulated Chemokine/CCL17 | Details |
TCEV ELISA KITS | Details |
Spin Column Animal Total RNA Purification Kit | Details |
Recombinant Mouse Pulmonary Surfactant-associated Protein D , C-6His, Human Cells | Details |
Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2 (27-220), C-6His, Human Cells | Details |
Recombinant Mouse Death Receptor 6 , C-Fc-6His, Human cells | Details |
Recombinant Mouse Triggering Receptor Expressed On Myeloid Cells-like Protein 2 , C-6His, Human Cells | Details |
Recombinant Mouse Thymic Stromal Lymphopoietin , C-Fc, Human cells | Details |
Recombinant Anti-SARS-CoV-2 S1 mouse monoclonal antibody | Details |
Spin Column RNA Cleanup & Concentration Kit | Details |
Chikusetsusaponin Ib | C47H74O18 | 59252-87-8 | Details |
Recombinant Mouse T Cell Immunoreceptor With Ig And ITIM Domains , C-6His, Human Cells | Details |
Recombinant Mouse Thrombopoietin , C-6His, Human Cells | Details |
Recombinant Mouse Transferrin Receptor Protein 1 , N-8His, Human Cells | Details |
Recombinant Mouse Trefoil Factor 3 , C-6His, Human Cells | Details |
Recombinant Mouse Developmental Tyrosine Kinase/Tyrosine Protein Kinase Receptor TYRO3 , C-mFc, Human cells | Details |
Recombinant Mouse V-set And Immunoglobulin Domain-containing Protein 8 , C-6His, Human Cells | Details |
ANS, 8-Anilino-1-naphthalenesulfonic acid hydrate | C16H13NO3S | 82-76-8 | Details |
Recombinant Murine Vascular Endothelial | Details |
Neuropeptide K, porcine DADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLM-NH2 | Details |
Raddeanin A | C47H76O16 | 89412-79-3 | Details |
Chikusetsusaponin IVa, 10 mM in DMSO | C42H66O14 | 51415-02-2 | Details |
Recombinant Mouse C-X-C Motif Chemokine 12 , None, E.coli | Details |
Recombinant Mouse Trefoil Factor 2 , C-6His, Human Cells | Details |
Recombinant Mouse CD27 Antigen , C-Fc-6His, Human Cells | Details |
Recombinant Mouse Transforming Growth Factor-beta Receptor Type II , C-6His, Human Cells | Details |
Recombinant Mouse Tumor Necrosis Factor Receptor Superfamily Member 5 (20-193), C-6His, Human cells | Details |
Recombinant Mouse Vascular Endothelial Growth Factor D , C-6His, Human cells | Details |
Secretin (5-27), porcine | C115H200N38O34 | 19665-15-7 | Details |
Recombinant Murine Thymus Expressed Chemokine/CCL25 | Details |
PEDV LFD Strips | Details |
Spin Column Yeast Total RNA Purification Kit | Details |
Product Total: Product Page: | ||||
450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 |