
Glucagon NEW
Price | Get Latest Price |
Package | 1kg |
Min. Order: | 1kg |
Supply Ability: | 1000 |
Update Time: | 2025-03-06 |
Product Details
Product Name: Glucagon | CAS No.: 16941-32-5 |
EC-No.: 685-611-6 | Min. Order: 1kg |
Purity: 97% | Supply Ability: 1000 |
Release date: 2025/03/06 |
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 685-611-6 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5 |
Mol File: | 16941-32-5.mol |
![]() |
Company Profile Introduction
Hebei Junhua Import and Export Co., Ltd. set sail in 2023. The company adheres to the core value of "Professionalism Builds Trust" and has won unanimous recognition from customers with its profound professional foundation.
We always stay at the forefront of innovation, constantly explore the infinite possibilities of chemical technology, and integrate the concept of innovation into every product research and development. With a strict quality control system, we ensure that every product enters the market with high quality and high stability, fully meeting the diversified needs of customers. At the same time, we always adhere to the customer - centered concept, equipped with a professional service team, providing customers with one - stop high - quality services from pre - sales consultation to after - sales maintenance, and interpreting our commitment to customers with practical actions.
We firmly believe that through unremitting efforts, we can surely create "Better Chemicals, Better Future". In the future journey, Hebei Junhua Import and Export Co., Ltd. will continue to forge ahead and work hand in hand with you to create a beautiful tomorrow in the chemical industry.
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$66.00/1mg |
VIP3Y
|
TargetMol Chemicals Inc.
|
2024-11-15 | |
$30.00/1kg |
VIP1Y
|
Shandong Deshang Chemical Co., Ltd.
|
2024-07-10 | |
$22.00/1box |
VIP1Y
|
Shanghai Getian Industrial Co., LTD
|
2024-05-11 | |
$0.00/1g |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-15 | |
$30.00/1box |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-03-20 | |
$10.00/1kg |
Nantong Guangyuan Chemicl Co,Ltd
|
2023-11-14 | ||
$70.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-02 | |
$40.00/50BOX |
Shanghai Chinqesen Biotechnology Co., Ltd.
|
2023-10-31 | ||
$20.00/1g |
Shanghai Yunao International Trade Co., Ltd
|
2023-10-11 | ||
$99.00/1kg |
Anhui Ruihan Technology Co., Ltd
|
2023-08-17 |
- Since: 2023-12-26
- Address: No. 368, Friendship North Street, Xisanzhuang Street, Xinhua District, Shijiazhuang City, Hebei Prov
INQUIRY