FOX04 D-Retro-Inverso
Price | Get Latest Price |
Package | 10vial |
Min. Order: | 10vial |
Supply Ability: | 50000 |
Update Time: | 2022-04-21 |
Product Details
Product Name: FOX04 D-Retro-Inverso | Min. Order: 10vial |
Purity: 98%+ | Supply Ability: 50000 |
Release date: 2022/04/21 | |
Top color: customzied |
FOX04 D-Retro-Inverso peptide
also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
package :10mg/vial, 10 vials/box
FAQ:
Q1: Do you offer free sample?
A: Of course, we will offer free sample if you pay shipping fees.
Q2: How to solve the quality problem?
A: We supply high quality products and quality issue near to zero. If it happens caused by occasional?case, we will reship again or compensate customer loss, but customer need show us the evidence of problems or test report.
Q3: Whether transportation is safe and whether to reship if seized?
A: Yes, we offer almost 100% Shipping line with safe delivery. If seized unfortunately, we will ship and I am sure no custom issue.
Q4: ETA ?
A: Pack sent out in 2-3 days and offer tracking numbers after payment. ETA not the same decide by destination country. Please contact us for details (always 10-15 days).
Q5: Do you have any discount?
A: The price is negotiable. Plz shoot us your order content, we will quote a fair price.
Q6: What is your minimum order ?
A: Usually MOQ is 100g. But depends on the items and your requirements, we also can support small quantity, such as 20g and 50g.
Q7: How to order?
A: E-mail or message us that includes your order like format below:
product A ? 100g
product B ? 10vials
delivery country:
Our sales will quote a total cost includes shipping fees and each item fees in 12 hours regularly.
Our will satisfy your purchase and supply professional guide.
Company Profile Introduction
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$47.00/5mg |
VIP5Y
|
TargetMol Chemicals Inc.
|
2024-11-19 | |
$47.00/5mg |
VIP3Y
|
TargetMol Chemicals Inc.
|
2024-11-19 | |
$0.00/1g |
Sichuan Tai Hui Biotechnology Co., Ltd
|
2024-05-17 |
- Since: 2016-06-27
- Address: No. 02, Floor 7, Building 7, Guannan Fuxing Medical Park, No.58 Optics Valley Avenue, East Lake New