CJC1295 NEW
Price | $10 | $50 | $100 |
Package | 1kg | 5kg | 25kg |
Min. Order: | 1kg |
Supply Ability: | 5000 Metric Ton/Month |
Update Time: | 2024-04-02 |
Product Details
Product Name: CJC1295 | CAS No.: 863288-34-0 |
EC-No.: 206-141-6 | Min. Order: 1kg |
Purity: 99% | Supply Ability: 5000 Metric Ton/Month |
Release date: 2024/04/02 |
Basic information
Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl CJC-1295(10mg)
CAS NO:863288-34-0
Molecular Formula: C152H252N44O42
Molecular Weight: 3367.89688
EINECS: N/A
Product Categories: Peptides
Mol File: 863288-34-0.mol
Article Data: 0
Chemical Properties
Melting Point: N/A
Boiling Point: N/A
Flash Point: N/A
Appearance: White Lyophilized Powder
Density: 1.45
Refractive Index: N/A
Storage Temp.: -20°C Freezer, Under inert atmosphere
Solubility: Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
CAS DataBase Reference: CJC1295(CAS DataBase Reference)
NIST Chemistry Reference: CJC1295(863288-34-0)
EPA Substance Registry System: CJC1295(863288-34-0)
Safety Data
Hazard Codes: N/A
Statements: N/A
Safety Statements: N/A
WGK Germany:
RTECS:
HazardClass: N/A
PackingGroup: N/A
Hazardous Substances Data: 863288-34-0(Hazardous Substances Data)
Package & Delivery:
Packing: 1kg/bag, 25kg/drum, Standard export packing or as clients'requirement packing
Express: EMS/ DHL/ FedEx/ TNT/ UPS
Delivery: Within 3-10 days upon receipt of your payment
Payment:
T/T, WesternUnion,money gram,bitcoin ,bank transfer and paypal and so on
Company Profie:
Wuhan Xinhao Biotechnology Co., Ltd specializes in the production of organic intermediates, pharmaceutical intermediates, silicones, fluorine, flavors and fragrances intermediates, and has more than 3,000 pharmaceutical intermediates.
We also offer customized synthesis and custom production services ranging in size from grams to kilograms to tons.
The company has its own quality control laboratory, with high-performance liquid chromatography, gas chromatography, spectrophotometer and other complete testing equipment, can be confirmed before leaving the factory.
We also have a professional sales team that provides pre-sales and after-sales services 24 hours a day, and your enquiries or questions will be processed within 12 hours.
Customer satisfaction and long-term cooperation are our ultimate goal, and we are committed to helping our customers with our quality products. For HPLC, GCMS, NMR and COA of product test data, please feel free to contact us.
FAQ
Q1. Can I have a sample order for your products
A: Yes, we welcome sample order to test and check quality. Mixed samples are acceptable.
Q2. What about the lead time
A:Sample needs 3-5 days, mass production time needs 1-2 weeks for order quantity more than
Q3. Do you have any MOQ limit for order
A: Low MOQ, 10-100g for sample checking is available
Q4. How do you ship the goods and how long does it take to arrive
A: We usually ship by DHL, UPS, FedEx or TNT. It usually takes 3-5 days to arrive. Airline and sea shipping also optional.
Q5. How to proceed an order for your products
A: First let us know your requirements or application.Then,We quote according to your requirements or our suggestions.After that, customer confirms the samples and places deposit for formal order.Finally,We arrange the production.
Q6. Is it OK to print my logo on package
A: Yes. Please inform us formally before our production and confirm the design firstly based on our sample.
Q7: Are you trading company or manufacturer
A: We are chemical factory in China. So we can provide wholesale price.
Company Profile Introduction
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$5.00/1BOX |
VIP1Y
|
Hefei zhanzhanda trading Co., LTD
|
2024-10-29 | |
$0.00/1G |
VIP1Y
|
CONTIDE BIOTECH CO.,LTD
|
2024-10-17 | |
$0.00/10box |
VIP1Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2024-10-12 | |
$20.00/1kg |
VIP1Y
|
Shaanxi Franta Biotechnology Co., Ltd
|
2024-09-23 | |
$45.00/1Box |
VIP1Y
|
Qingdao Xinli Technology Development Co., Ltd.
|
2024-07-25 | |
$5.00/5mg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-27 | |
$0.10/20mg |
VIP1Y
|
Shanghai Likang New Materials Co., Limited
|
2024-05-28 | |
$85.00/1box |
VIP1Y
|
Strong peptide cross-border e-commerce Co. LTD
|
2024-05-23 | |
$50.00/1KG |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-05-13 | |
$50.00/1box |
VIP1Y
|
Hebei Zhuanglai Chemical Trading Co.,Ltd
|
2024-05-11 |
- Since: 2023-03-29
- Address: A16, Building 1, No. 58 Guanggu Avenue, Donghu New Technology Development Zone, Wuhan City, Hubei Pr
+86-18120578002
xinhao-6@xinhaoshengwu.com