成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> Glucagon

Glucagon

Glucagon price.
  • $71 - $2727.77
  • Product name: Glucagon
  • CAS: 16941-32-5
  • MF: C153H225N43O49S
  • MW: 3482.75
  • EINECS:685-611-6
  • MDL Number:MFCD00167532
  • Synonyms:GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl
37 prices
Selected condition：
Brand
  • Alfa Aesar
  • American Custom Chemicals Corporation
  • Apolloscientific
  • AvaChem
  • Cayman Chemical
  • ChemScene
  • DC Chemicals
  • Sigma-Aldrich
  • Usbiological
Package
  • 10ug
  • 0.1mg
  • 100ug
  • 0.5mg
  • 1mg
  • 4mg
  • 5MG
  • 2x2.94mg
  • 10mg
  • 25mg
  • 50mg
  • 100mg
  • 1g
  • 96Tests
  • ManufacturerAlfa Aesar
  • Product numberJ60827
  • Product descriptionGlucagon (1-29), human
  • Packaging0.5mg
  • Price$177
  • Updated2023-06-20
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ60827
  • Product descriptionGlucagon (1-29), human
  • Packaging1mg
  • Price$306
  • Updated2023-06-20
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0001463
  • Product descriptionGLUCAGON (1 - 29) 95.00%
  • Packaging1MG
  • Price$427.35
  • Updated2021-12-16
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberPEP0001463
  • Product descriptionGLUCAGON (1 - 29) 95.00%
  • Packaging5MG
  • Price$2727.77
  • Updated2021-12-16
  • Buy
  • ManufacturerApolloscientific
  • Product numberBITH3022
  • Product descriptionGlucagon
  • Packaging4mg
  • Price$513
  • Updated2021-12-16
  • Buy
  • ManufacturerApolloscientific
  • Product numberBITH3022
  • Product descriptionGlucagon
  • Packaging50mg
  • Price$1240
  • Updated2021-12-16
  • Buy
  • ManufacturerAvaChem
  • Product number2220
  • Product descriptionGlucagon
  • Packaging5mg
  • Price$235
  • Updated2021-12-16
  • Buy
  • ManufacturerAvaChem
  • Product number2220
  • Product descriptionGlucagon
  • Packaging25mg
  • Price$435
  • Updated2021-12-16
  • Buy
  • ManufacturerAvaChem
  • Product number2220
  • Product descriptionGlucagon
  • Packaging100mg
  • Price$850
  • Updated2021-12-16
  • Buy
  • ManufacturerAvaChem
  • Product number2220
  • Product descriptionGlucagon
  • Packaging1g
  • Price$2350
  • Updated2021-12-16
  • Buy
  • ManufacturerCayman Chemical
  • Product number24204
  • Product descriptionGlucagon ≥95%
  • Packaging1mg
  • Price$71
  • Updated2022-04-27
  • Buy
  • ManufacturerCayman Chemical
  • Product number24204
  • Product descriptionGlucagon ≥95%
  • Packaging5mg
  • Price$281
  • Updated2022-04-27
  • Buy
  • ManufacturerCayman Chemical
  • Product number24204
  • Product descriptionGlucagon ≥95%
  • Packaging10mg
  • Price$492
  • Updated2022-04-27
  • Buy
  • ManufacturerCayman Chemical
  • Product number24204
  • Product descriptionGlucagon ≥95%
  • Packaging25mg
  • Price$966
  • Updated2022-04-27
  • Buy
  • ManufacturerChemScene
  • Product numberCS-5936
  • Product descriptionGlucagon(1-29),bovine,human,porcine 99.81%
  • Packaging1mg
  • Price$72
  • Updated2021-12-16
  • Buy
  • ManufacturerChemScene
  • Product numberCS-5936
  • Product descriptionGlucagon(1-29),bovine,human,porcine 99.81%
  • Packaging5mg
  • Price$216
  • Updated2021-12-16
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J60827 Glucagon (1-29), human 0.5mg $177 2023-06-20 Buy
Alfa Aesar J60827 Glucagon (1-29), human 1mg $306 2023-06-20 Buy
American Custom Chemicals Corporation PEP0001463 GLUCAGON (1 - 29) 95.00% 1MG $427.35 2021-12-16 Buy
American Custom Chemicals Corporation PEP0001463 GLUCAGON (1 - 29) 95.00% 5MG $2727.77 2021-12-16 Buy
Apolloscientific BITH3022 Glucagon 4mg $513 2021-12-16 Buy
Apolloscientific BITH3022 Glucagon 50mg $1240 2021-12-16 Buy
AvaChem 2220 Glucagon 5mg $235 2021-12-16 Buy
AvaChem 2220 Glucagon 25mg $435 2021-12-16 Buy
AvaChem 2220 Glucagon 100mg $850 2021-12-16 Buy
AvaChem 2220 Glucagon 1g $2350 2021-12-16 Buy
Cayman Chemical 24204 Glucagon ≥95% 1mg $71 2022-04-27 Buy
Cayman Chemical 24204 Glucagon ≥95% 5mg $281 2022-04-27 Buy
Cayman Chemical 24204 Glucagon ≥95% 10mg $492 2022-04-27 Buy
Cayman Chemical 24204 Glucagon ≥95% 25mg $966 2022-04-27 Buy
ChemScene CS-5936 Glucagon(1-29),bovine,human,porcine 99.81% 1mg $72 2021-12-16 Buy
ChemScene CS-5936 Glucagon(1-29),bovine,human,porcine 99.81% 5mg $216 2021-12-16 Buy

Properties

Density :1.53±0.1 g/cm3(Predicted)
storage temp. :Keep in dark place,Sealed in dry,2-8°C
solubility :Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
form :powder
color :White to off-white
Water Solubility :Soluble to 1 mg/ml in water
InChI :InChI=1/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/s3
InChIKey :MASNOZXLGMXCHN-SXVMFYJYNA-N
SMILES :C12C=CC=CC=1NC=C2C[C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@H](C(=O)O)[C@H](O)C)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@H](O)C)NC(=O)[C@@H](NC(=O)[C@H]([C@H](O)C)NC(=O)CNC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1N=CNC=1)CC1C=CC=CC=1)CC1C=CC(O)=CC=1)CC1C=CC(O)=CC=1)CC1C=CC=CC=1 |&1:10,14,22,30,38,42,48,57,64,68,76,85,90,101,112,118,126,134,138,147,153,157,165,171,172,178,182,183,193,202,208,r|

Safety Information

Symbol(GHS): GHS hazard pictogramsGHS hazard pictograms
Signal word: Danger
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H317 May cause an allergic skin reaction Sensitisation, Skin Category 1 Warning GHS hazard pictograms P261, P272, P280, P302+P352,P333+P313, P321, P363, P501
H332 Harmful if inhaled Acute toxicity,inhalation Category 4 Warning GHS hazard pictograms P261, P271, P304+P340, P312
H334 May cause allergy or asthma symptoms or breathing difficulties if inhaled Sensitisation, respiratory Category 1 Danger GHS hazard pictograms P261, P285, P304+P341, P342+P311,P501
Precautionary statements:
P261 Avoid breathing dust/fume/gas/mist/vapours/spray.
P271 Use only outdoors or in a well-ventilated area.
P272 Contaminated work clothing should not be allowed out of the workplace.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P285 In case of inadequate ventilation wear respiratory protection.
P302+P352 IF ON SKIN: wash with plenty of soap and water.
P304+P340 IF INHALED: Remove victim to fresh air and Keep at rest in a position comfortable for breathing.
P304+P341 IF INHALED: If breathing is difficult, remove victim to fresh air and keep at rest in a position comfortable for breathing.
P312 Call a POISON CENTER or doctor/physician if you feel unwell.
P321 Specific treatment (see … on this label).
P333+P313 IF SKIN irritation or rash occurs: Get medical advice/attention.
P342+P311 IF experiencing respiratory symptoms: call a POISON CENTER or doctor/physician.
P363 Wash contaminated clothing before reuse.
P501 Dispose of contents/container to..…

Description

A peptide hormone that plays a role in maintaining glucose homeostasis

Related product price