CECROPIN B
- $63 - $1478.25
- Product name: CECROPIN B
- CAS: 80451-05-4
- MF: C176H302N52O41S
- MW: 3834.66988
- EINECS:
- MDL Number:MFCD00130753
- Synonyms:KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2;H-LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;CECROPIN B;LYS-TRP-LYS-VAL-PHE-LYS-LYS-ILE-GLU-LYS-MET-GLY-ARG-ASN-ILE-ARG-ASN-GLY-ILE-VAL-LYS-ALA-GLY-PRO-ALA-ILE-ALA-VAL-LEU-GLY-GLU-ALA-LYS-ALA-LEU-NH2;Aids096161;Aids-096161;Cecropin B (Platysamiacecropia antibacterial peptide) (9CI);Cecropin B, ≥97% (HPLC)
25 prices
Selected condition:
Brand
- Alfa Aesar
- Biorbyt Ltd
- Biosynth Carbosynth
- ChemScene
- DC Chemicals
- Sigma-Aldrich
- TRC
- Usbiological
Package
- 100ug
- 0.1mg
- 250ug
- 500ug
- 1mg
- 2mg
- 2.5mg
- 5mg
- 10mg
- ManufacturerAlfa Aesar
- Product numberJ66068
- Product descriptionCecropin B, amide
- Packaging1mg
- Price$370
- Updated2023-06-20
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66068
- Product descriptionCecropin B, amide
- Packaging5mg
- Price$721
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66068
- Product descriptionCecropin B, amide
- Packaging10mg
- Price$1030
- Updated2021-12-16
- Buy
- ManufacturerAlfa Aesar
- Product numberJ66041
- Product descriptionCecropin B free acid
- Packaging10mg
- Price$1211
- Updated2023-06-20
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611693
- Product descriptionCecropin B
- Packaging1mg
- Price$287.3
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611693
- Product descriptionCecropin B
- Packaging5mg
- Price$630.7
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611693
- Product descriptionCecropin B
- Packaging10mg
- Price$793.9
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73321
- Product descriptionCecropin B
- Packaging100ug
- Price$63
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73321
- Product descriptionCecropin B
- Packaging250ug
- Price$125
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108880
- Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging250ug
- Price$132.5
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73321
- Product descriptionCecropin B
- Packaging500ug
- Price$220
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108880
- Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging500ug
- Price$230
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC73321
- Product descriptionCecropin B
- Packaging1mg
- Price$380
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108880
- Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging1mg
- Price$400
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108880
- Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging2mg
- Price$680
- Updated2021-12-16
- Buy
- ManufacturerBiosynth Carbosynth
- Product numberFC108880
- Product descriptionCecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
- Packaging5mg
- Price$1478.25
- Updated2021-12-16
- Buy
Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
---|---|---|---|---|---|---|
Alfa Aesar | J66068 | Cecropin B, amide | 1mg | $370 | 2023-06-20 | Buy |
Alfa Aesar | J66068 | Cecropin B, amide | 5mg | $721 | 2021-12-16 | Buy |
Alfa Aesar | J66068 | Cecropin B, amide | 10mg | $1030 | 2021-12-16 | Buy |
Alfa Aesar | J66041 | Cecropin B free acid | 10mg | $1211 | 2023-06-20 | Buy |
Biorbyt Ltd | orb611693 | Cecropin B | 1mg | $287.3 | 2021-12-16 | Buy |
Biorbyt Ltd | orb611693 | Cecropin B | 5mg | $630.7 | 2021-12-16 | Buy |
Biorbyt Ltd | orb611693 | Cecropin B | 10mg | $793.9 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73321 | Cecropin B | 100ug | $63 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73321 | Cecropin B | 250ug | $125 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108880 | Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | 250ug | $132.5 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73321 | Cecropin B | 500ug | $220 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108880 | Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | 500ug | $230 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC73321 | Cecropin B | 1mg | $380 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108880 | Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | 1mg | $400 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108880 | Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | 2mg | $680 | 2021-12-16 | Buy |
Biosynth Carbosynth | FC108880 | Cecropin B H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 | 5mg | $1478.25 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :powder
color :White to off-white
Water Solubility :Water : 20 mg/mL (5.22 mM)
Sequence :H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
form :powder
color :White to off-white
Water Solubility :Water : 20 mg/mL (5.22 mM)
Sequence :H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
Safety Information
Symbol(GHS): | ||||||||
---|---|---|---|---|---|---|---|---|
Signal word: | ||||||||
Hazard statements: |
|
|||||||
Precautionary statements: |
|
Description
Cecropin B is an antibacterial peptide isolated from pig intestine and moths.Related product price
- CECROPIN A
$115-2159 - COBALT(II) ACETYLACETONATE
$43-524 - BENZYL ISOCYANIDE
$82-2194.5
Suppliers and manufacturers
Shenzhen Nexconn Pharmatechs Ltd
Cellmano Biotech Limited
Career Henan Chemica Co
BOC Sciences
Zhejiang J&C Biological Technology Co.,Limited
Hangzhou Go Top Peptide Biotech
Chengdu Youngshe Chemical Co., Ltd.