Identification | Back Directory | [Name]
(SER79)-PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT | [CAS]
215777-46-1 | [Synonyms]
PubChem ID: 121235514 (SER8)-GLP-1 (7-36) AMIDE (HUMAN) (Ser8)-Glucagon-LikePeptide1(7-36)amide 22:PN:WO0155213 SEQID:22 claimed sequence (SER8)-GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN) 8-L-Serine-36-L-argininamide-7-36-glucagon-like peptide I (human) (Ser?)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) 7-36-Glucagon-like peptide I (human), 8-L-serine-36-L-argininamide- (SER8)-GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT (SER79)-PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT (SER99)-PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT (SER8)-GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT H-HIS-SER-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 HIS-SER-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2: HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (Ser79)-Proglucagon (78-107) aMide (huMan, bovine, guinea pig, Mouse, rat), (Ser8)-Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), (Ser99)-Preproglucagon (98-127) aMide (huMan, bovine, guinea pig, Mouse, rat) (Ser8)-GLP-1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat)
(Ser79)-Proglucagon (78-107) aMide (huMan, bovine, guinea pig, Mouse, rat), (Ser8)-Glucagon-Like Peptide 1 (7-36) aMide (huMan, bovine, guinea pig, Mouse, rat), (Ser99)-Preproglucagon (98-1 | [Molecular Formula]
C149H226N40O46 | [MDL Number]
MFCD02266190 | [MOL File]
215777-46-1.mol | [Molecular Weight]
3313.63 |
Hazard Information | Back Directory | [Uses]
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion[1]. | [References]
[1] J Schirra, et al. Effects of glucagon-like peptide-1(7-36)amide on motility and sensation of the proximal stomach in humans. Gut. 2002 Mar;50(3):341-8. DOI:10.1136/gut.50.3.341 |
|
Company Name: |
BOC Sciences
|
Tel: |
1-631-485-4226; 16314854226 |
Website: |
https://www.bocsci.com |
|