Identification | Back Directory | [Name]
PEPTIDE YY, HUMAN | [CAS]
118997-30-1 | [Synonyms]
PYY (HUMAN) Human peptide YY PEPTIDE YY, HUMAN PEPTIDE YY PYY HUMAN PubChem ID: 126455957 Peptide YY (human) Acetate PEPTIDE YY, HUMAN USP/EP/BP M.W. 4309.75 C194H295N55O57 Peptide YY human, ≥97% (HPLC) PEPTIDE TYROSINE TYROSINE, HUMAN YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 Peptide YY (human)|Peptide YY, PYY, human TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 H-TYR-PRO-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 PYY, Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 acetate salt | [Molecular Formula]
C194H295N55O57 | [MDL Number]
MFCD00081843 | [MOL File]
118997-30-1.mol | [Molecular Weight]
4309.75 |
Chemical Properties | Back Directory | [storage temp. ]
−20°C
| [form ]
Solid | [color ]
White to off-white | [biological source]
synthetic | [Water Solubility ]
1mg/mL in water | [Sequence]
H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
Hazard Information | Back Directory | [Uses]
Peptide YY human has been used as a supplement in Roswell Park Memorial Institute medium (RPMI medium) to culture pancreatic duct-derived cells. | [General Description]
Human peptide YY (PYY) is secreted by mucosal L cells in the distal ileum, colon and rectum. It consists of 36 amino acids. The gene encoding PYY is localized on human chromosome 17q21.1. | [Biochem/physiol Actions]
Gut hormone that inhibits both secretin and cholecystokinin-stimulated pancreatic secretion. Endogenous nonselective agonist at NPY receptors. |
|
|